PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593532.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 355aa    MW: 39917.1 Da    PI: 6.0228
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593532.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
   XP_013593532.1 14 KGAWTTEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.61.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
   XP_013593532.1  67 RGEFSSEEEQIIIMLHASRGNK-WSDIARHLP-RRTDNEVKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.192961IPR017930Myb domain
SuperFamilySSF466891.66E-2811108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-171461IPR001005SANT/Myb domain
CDDcd001672.98E-111661No hitNo description
PROSITE profilePS5129425.00762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2565117IPR009057Homeodomain-like
SMARTSM007172.9E-1466114IPR001005SANT/Myb domain
PfamPF002491.0E-1367112IPR001005SANT/Myb domain
CDDcd001672.92E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWTNY  60
LKPDVKRGEF SSEEEQIIIM LHASRGNKWS DIARHLPRRT DNEVKNYWNT HLKKRLIEQG  120
IDPMTHKPLA SNSNPTVNTP PENLHSLAAP SSDKQYSRSS SLPSLSRLTN KDGTPVQGGS  180
LSHKKSFKRS SSTSRLLNKV AAKVTSVKEI LSASMEGSLS ATTLPYASYS DGFSEQIRNG  240
EGSSNAFLTN TLAEFDPFSQ SPLYSEHEIN ATSDLGMDYD FSHFLEKLGR DDHNEENDMN  300
VEYGHDDLLM SDVSHEVSST SVDDRDNIFE NFEGWSNYLL DHADFVYDTE SDTLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8795910.0KJ879591.1 Brassica napus cultivar Ningyou7 chromosome C7 high aliphatic glucosinolate 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593532.10.0PREDICTED: transcription factor MYB28-like
RefseqXP_013593533.10.0PREDICTED: transcription factor MYB28-like
SwissprotQ9SPG20.0MYB28_ARATH; Transcription factor MYB28
TrEMBLA0A0D3DDK80.0A0A0D3DDK8_BRAOL; Uncharacterized protein
STRINGBra012961.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.20.0myb domain protein 28